PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000197330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 592aa    MW: 64661.8 Da    PI: 7.9132
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000197330genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.81.4e-19129175148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++++++v+++G+  W++Ia+ ++ gR +kqc++rw+++l
    MDP0000197330 129 KGPWTQEEDDKIIELVARYGPTKWSLIAKSLP-GRIGKQCRERWHNHL 175
                      79******************************.*************97 PP

2Myb_DNA-binding55.11.7e-17181224146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + +WT eE++ l +a++++G++ W+ Ia+ ++ gRt++ +k++w++
    MDP0000197330 181 KEAWTLEEELALMNAHQMHGNK-WAEIAKVLP-GRTDNAIKNHWNS 224
                      579*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.99156123IPR017877Myb-like domain
SMARTSM007176.0E-660125IPR001005SANT/Myb domain
SuperFamilySSF466894.74E-1062133IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-1663131IPR009057Homeodomain-like
CDDcd001673.34E-864123No hitNo description
PROSITE profilePS5129432.788124179IPR017930Myb domain
SuperFamilySSF466897.49E-32126222IPR009057Homeodomain-like
SMARTSM007172.3E-18128177IPR001005SANT/Myb domain
PfamPF002495.4E-19129175IPR001005SANT/Myb domain
CDDcd001671.60E-16131175No hitNo description
Gene3DG3DSA:1.10.10.602.5E-28132178IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-24179230IPR009057Homeodomain-like
PROSITE profilePS5129422.577180230IPR017930Myb domain
SMARTSM007172.7E-16180228IPR001005SANT/Myb domain
PfamPF002495.5E-16181224IPR001005SANT/Myb domain
CDDcd001671.46E-12183226No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 592 aa     Download sequence    Send to blast
MAGVKLEECC LENKQSTAAS SSSVSQGSGS GSAIIKSPGA CSPASASPTQ RRTSGPIRRA  60
KGGWTPQEDE TLRVAVAAFK GKSWKKIGGN DSAQQMCLTN LLNAEFFPDR SEVQCLHRWQ  120
KVLNPELVKG PWTQEEDDKI IELVARYGPT KWSLIAKSLP GRIGKQCRER WHNHLNPDIK  180
KEAWTLEEEL ALMNAHQMHG NKWAEIAKVL PGRTDNAIKN HWNSSLKKKL EFYLATGKLP  240
PPPKYGTKET RTSATKKLLV CSTKGSDSTA QTSSGNADMS KLDEDGKDQF ESAAPPQDMG  300
ASPSVHPNES ADSEGVKCNL RLSFMDLSCS NSDSGPKFEN FRVNRMPQIE NSVINSQAES  360
ENCVFNNQLD EDRVKTTSLP VETPGYGSLY YEPPPPESCA QFDSGFSNMH XLQYDYTSSP  420
NLSPISFFTP PSANGSGLCN QSPESILKIA AKTFPNTPSI LRKRKTIGQE QLPRNKVAIV  480
DXESGIVDCE SVREQERHKN SAEVSGSQDG SSCESPTNNG ISTIGSNGKA FNASPPYRLR  540
ARRTAVFKSV EKQLEFTCDK EYDANSKSME LSANGGSAVI KDSTHPTKMG VT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-65602305159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-65602305159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.159980.0bud| fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744600.0DQ074460.1 Malus x domestica MYB4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008369900.10.0PREDICTED: myb-related protein 3R-1 isoform X1
TrEMBLQ2LMF20.0Q2LMF2_MALDO; MYB4
STRINGVIT_08s0007g00360.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66163449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-150myb domain protein 3r-5